PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Seita.7G201600.2.p
Common NameSETIT_011884mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Cenchrinae; Setaria
Family G2-like
Protein Properties Length: 303aa    MW: 32292.7 Da    PI: 9.7631
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Seita.7G201600.2.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like97.87.7e-312073255
             G2-like  2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55
                        pr+rWt +LH++Fv+a+e LGG++kAtPk il++m+ kgLt++hvkSHLQ+YR 
  Seita.7G201600.2.p 20 PRMRWTADLHRSFVRAIECLGGQDKATPKLILQFMGAKGLTISHVKSHLQMYRA 73
                        9****************************************************6 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS512949.4711676IPR017930Myb domain
Gene3DG3DSA:1.10.10.603.1E-291674IPR009057Homeodomain-like
SuperFamilySSF466891.16E-151773IPR009057Homeodomain-like
TIGRFAMsTIGR015575.2E-232073IPR006447Myb domain, plants
PfamPF002491.2E-72172IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 303 aa     Download sequence    Send to blast
MGGGGGRNGA VRQYIRSKEP RMRWTADLHR SFVRAIECLG GQDKATPKLI LQFMGAKGLT  60
ISHVKSHLQM YRAARLGAGR RGMQAAQLQR RHSCAGDEQG PKEFLCPPLK RARMGTAVAY  120
ESMQGSHRIS EARTAAAAAA AGSLYCIDDY MQAMATRRRI KEEGLRWQRR DAAAAASSLQ  180
AVGCLVQESD PFKISRPEAN HLVLVPNQKQ GSVEDGNGNG CSLFGSFSTA AKDKPPEQCS  240
LSLSLGLDPN CTRAMAASSP SESSCILTAS PARRSSSDCS GHSDRFAGPG LSLELSLSTC  300
GF*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004976515.10.0PREDICTED: uncharacterized protein LOC101764946
TrEMBLK3YCD80.0K3YCD8_SETIT; Uncharacterized protein
STRINGSi011884m0.0(Setaria italica)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G14600.11e-26G2-like family protein